Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-3 (TVBJ3)

This Recombinant Human T cell receptor beta variable 10-3 (TVBJ3) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-3 TRBV10-3

UniProt

A0A0K0K1G6

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRHKVTETGTPVTLRCHQTENHRYMYWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCAISE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm3646 Mouse Gene Knockout Kit (CRISPR)
KN506819 1 Kit

Gm3646 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNA pol μ (C-1) : m-IgG Fc BP-HRP Bundle
sc-538776 1 Kit

DNA pol μ (C-1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Sal O Anti Grp C1 3Ml - EACH
229491 1 Each

Sal O Anti Grp C1 3Ml - EACH

Sign In for Pricing
View Details
tuf1 Antibody, HRP conjugated
A37723-50UG 50 µg

tuf1 Antibody, HRP conjugated

Sign In for Pricing
View Details
A4GALT Polyclonal Antibody, APC-Cy7 Conjugated
bs-25228R-APC-Cy7 100 µL

A4GALT Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
KHDRBS1 Antibody
GWB-MN550A 50 µg

KHDRBS1 Antibody

Sign In for Pricing
View Details