Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Non-specific lipid-transfer protein (SCP2)

Recombinant Human Non-specific lipid-transfer protein (SCP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SCP2. Target Synonyms: Propanoyl-CoA C-acyltransferase; SCP-chiSCPXSterol carrier protein 2; SCP-2Sterol carrier protein X; SCP-X. Accession Number: P22307. Expression Region: 1~143aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 42.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Non-specific lipid-transfer protein (SCP2) is a purified Recombinant Protein.

Accession Number

P22307

Expression Region

1~143aa

Host

E. coli

Target

SCP2

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform SCP2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Propanoyl-CoA C-acyltransferase; SCP-chiSCPXSterol carrier protein 2; SCP-2Sterol carrier protein X; SCP-X

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP6 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11546R-APC-Cy5.5 100 µL

DUSP6 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
GALK2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2526284 100 µL

GALK2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) REM8 Polyclonal Antibody
MBS9002077 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) REM8 Polyclonal Antibody

Sign In for Pricing
View Details
Ghrelin Receptor Rabbit Polyclonal Antibody (PE-Cy7)
orb870412 100 µL

Ghrelin Receptor Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
H3F3B Protein Vector (Rat) (pPB-N-His)
PV272183 500 ng

H3F3B Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
UTY Peptide - N-terminal region
orb2004085 100 µg

UTY Peptide - N-terminal region

Sign In for Pricing
View Details