Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTY Peptide - N-terminal region

UTY Peptide - N-terminal region

Product Specifications

Product Name Alternative

UTY1

UniProt

O14607

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTY Rabbit Polyclonal Antibody (orb574687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872601

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAP23 Antibody, HRP conjugated
A35253-100UG 100 µg

SNAP23 Antibody, HRP conjugated

Sign In for Pricing
View Details
NDR2 CRISPR/Cas9 KO Plasmid (m)
sc-433179 20 µg

NDR2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
ZFHX3 Polyclonal Antibody
E910644 100 µL

ZFHX3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ATF7 (SAA2118) (Mouse, Monoclonal, IgG2a)
A132675 100 µL

Anti-ATF7 (SAA2118) (Mouse, Monoclonal, IgG2a)

Sign In for Pricing
View Details
Danirixin
319712 50.0mg

Danirixin

Sign In for Pricing
View Details
Casein Kinase 2 Substrate [Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu] (CK2)
C2085-59 1 mg

Casein Kinase 2 Substrate [Arg-Arg-Glu-Glu-Glu-Thr-Glu-Glu-Glu] (CK2)

Sign In for Pricing
View Details