Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CHRNA1. Target Synonyms: Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic. Accession Number: P02708. Expression Region: 21~255aa. Tag Info: N-Terminal 6Xhis-Trx-Tagged. Theoretical MW: 44.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein.

Accession Number

P02708

Expression Region

21~255aa

Host

E. coli

Target

CHRNA1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Trx-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of P02708-1

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic; alpha polypeptide 1 (muscle) ; Chrna1; CMS1A; CMS1B; CMS2A; FCCMS; Nicotinic cholinergic receptor alpha 1; SCCMS; Schizophrenia neurophysiologic defect candidate

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Neuron Derived Orphan Receptor 1 (NOR1) ELISA Kit
QY-E10026 96 Tests

Rat Neuron Derived Orphan Receptor 1 (NOR1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Danio rerio Cyclin-F (ccnf), partial
MBS1358601 Inquire

Recombinant Danio rerio Cyclin-F (ccnf), partial

Sign In for Pricing
View Details
P-selectin antagonist 1
HY-161646 Inquire

P-selectin antagonist 1

Sign In for Pricing
View Details
GPR82 Protein Vector (Human) (pPB-N-His)
PV018530 500 ng

GPR82 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CCL27 polyclonal antibody
BS79286-01 50 µL

CCL27 polyclonal antibody

Sign In for Pricing
View Details
CCL27 polyclonal antibody
BS79286-02 100 µL

CCL27 polyclonal antibody

Sign In for Pricing
View Details