Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) is a purified CF Transmembrane Protein. Purity: >90% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fcer1a. Target Synonyms: Fc-epsilon RI-alpha. Accession Number: P20489. Expression Region: 24~250aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) is a purified CF Transmembrane Protein.

Accession Number

P20489

Expression Region

24~250aa

Host

E. coli

Target

Fcer1a

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fc-epsilon RI-alpha

Species

Mouse (Mus musculus)

Protein Name

CF Transmembrane Protein

AA Sequence

ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fer Tyr402 Rabbit Polyclonal Antibody
E53P03913 100 µL

Fer Tyr402 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ganglioside GD2, Disialo, Human Brain
sc-204761 500 µg

Ganglioside GD2, Disialo, Human Brain

Sign In for Pricing
View Details
Recombinant Rat Platelet-activating factor receptor (Ptafr)
orb2905628-01 20 µg

Recombinant Rat Platelet-activating factor receptor (Ptafr)

Sign In for Pricing
View Details
Recombinant Rat Platelet-activating factor receptor (Ptafr)
orb2905628-02 100 µg

Recombinant Rat Platelet-activating factor receptor (Ptafr)

Sign In for Pricing
View Details
CK1 alpha antibody (Thr321)
70R-35499 0.1 mg

CK1 alpha antibody (Thr321)

Sign In for Pricing
View Details
Rabbit Polyclonal NNT Antibody [Alexa Fluor 350]
NBP2-99302AF350 0.1 mL

Rabbit Polyclonal NNT Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details