Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Platelet-activating factor receptor (Ptafr)

This Recombinant Rat Platelet-activating factor receptor (Ptafr) spans the amino acid sequence from region 1-341.

Product Specifications

Product Name Alternative

Platelet-activating factor receptor, PAF-R, PAFr

UniProt

P46002

Expression Region

1-341

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC29 (NM_031956) Human Over-expression Lysate
LS083894 100 µg

TTC29 (NM_031956) Human Over-expression Lysate

Sign In for Pricing
View Details
Mypn sgRNA CRISPR Lentivector (Rat) (Target 2)
K7609403 1.0 µg DNA

Mypn sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MPZL1 Rabbit Polyclonal Antibody
orb258880 100 µg

MPZL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Donkey Protein Kinase, Amp Activated Alpha 1 ELISA Kit
MBS072270 Inquire

Donkey Protein Kinase, Amp Activated Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Dbx1 Pre-designed siRNA Set B
SI103417B 1 Each

Mouse Dbx1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Met discontinued
391536 200 µL

Met discontinued

Sign In for Pricing
View Details