Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-like protein FUBI (FAU)

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FAU. Target Synonyms: FAU; Ubiquitin-like protein FUBI. Accession Number: NM_001997. Expression Region: 1~133aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 41.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-like protein FUBI (FAU) is a purified Recombinant Protein.

Accession Number

NM_001997

Expression Region

1~133aa

Host

E. coli

Target

FAU

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

41.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FAU; Ubiquitin-like protein FUBI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I) (Azide free) (HRP) discontinued
036734-HRP 200 µL

HOXD13, ID (HOXD13, HOX4I, Homeobox protein Hox-D13, Homeobox protein Hox-4I) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
0610007P22Rik (BC027751) Mouse Tagged Lenti ORF Clone
MR202731L4 10 µg

0610007P22Rik (BC027751) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398885-01 48 Well

Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398885-02 96 Well

Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398885-03 5x 96 Well

Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit
MBS9398885-04 10x 96 Well

Mouse Tumor Necrosis Factor Alpha Converting Enzyme (TACE) ELISA Kit

Sign In for Pricing
View Details