Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Beta-lactamase CTX-M-1 (bla)

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: bla. Target Synonyms: Beta-lactamase MEN-1Cefotaximase 1. Accession Number: P28585. Expression Region: 29~291aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein.

Accession Number

P28585

Expression Region

29~291aa

Host

E. coli

Target

Bla

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-lactamase MEN-1Cefotaximase 1

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1737 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34174126 3x 1.0µg DNA

Olr1737 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mouse RAD51D siRNA
abx930778-01 15 nmol

Mouse RAD51D siRNA

Sign In for Pricing
View Details
Mouse RAD51D siRNA
abx930778-02 30 nmol

Mouse RAD51D siRNA

Sign In for Pricing
View Details
CD4 Antibody
V2381SAF-100UG 100 µg

CD4 Antibody

Sign In for Pricing
View Details
Entpd4 3'UTR Luciferase Stable Cell Line
TU105842 1.0 mL

Entpd4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GFAP Mouse mAb, BF555 conjugated
orb2837822 100 µL

GFAP Mouse mAb, BF555 conjugated

Sign In for Pricing
View Details