Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-1, Human (HEK293, C-His)

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-1, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MMP-1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-1-protein-human-hek293-c-his.html

Purity

98.0

Smiles

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Molecular Formula

4312 (Gene_ID) P03956 (F20-N469) (Accession)

Molecular Weight

Approximately 56 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Lamin A/C (Ser22) Antibody
MBS9612820-01 0.1 mL

Phospho-Lamin A/C (Ser22) Antibody

Sign In for Pricing
View Details
Phospho-Lamin A/C (Ser22) Antibody
MBS9612820-02 0.2 mL

Phospho-Lamin A/C (Ser22) Antibody

Sign In for Pricing
View Details
Phospho-Lamin A/C (Ser22) Antibody
MBS9612820-03 5x 0.2 mL

Phospho-Lamin A/C (Ser22) Antibody

Sign In for Pricing
View Details
CENPA Rabbit Monoclonal Antibody
AMRe85136-01 1 Each

CENPA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CENPA Rabbit Monoclonal Antibody
AMRe85136-02 50 µL

CENPA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CENPA Rabbit Monoclonal Antibody
AMRe85136-03 100 µL

CENPA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details