Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SSX4 (SSX4)

Product Specifications

Product Name Alternative

(Cancer/testis antigen 5.4) (CT5.4)

Abbreviation

Recombinant Human SSX4 protein

Gene Name

SSX4

UniProt

O60224

Expression Region

1-188aa

Organism

Homo sapiens (Human)

Target Sequence

MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Could act as a modulator of transcription.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.9 kDa

References & Citations

"CD4+ T cell responses to SSX-4 in melanoma patients." Ayyoub M., Merlo A., Hesdorffer C.S., Rimoldi D., Speiser D., Cerottini J.C., Chen Y.T., Old L.J., Stevanovic S., Valmori D. J. Immunol. 174:5092-5099 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flamma® 648 Isothiocyanate
KWI1215_5 mg 5 mg

Flamma® 648 Isothiocyanate

Sign In for Pricing
View Details
ZYG11BL Double Nickase Plasmid (m2)
sc-432725-NIC-2 20 µg

ZYG11BL Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Bacterial RV1984C protein
orb419132-01 20 µg

Bacterial RV1984C protein

Sign In for Pricing
View Details
Bacterial RV1984C protein
orb419132-02 100 µg

Bacterial RV1984C protein

Sign In for Pricing
View Details
Bacterial RV1984C protein
orb419132-03 1 mg

Bacterial RV1984C protein

Sign In for Pricing
View Details
Rabbit Polyclonal Ephrin-B2 Antibody [mFluor Violet 500 SE]
NBP2-99653MFV500 0.1 mL

Rabbit Polyclonal Ephrin-B2 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details