Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial RV1984C protein

This Bacterial RV1984C protein spans the amino acid sequence from region 33-217aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rv1984c, MTCY39.35Probable cutinase Rv1984c, EC 3.1.1.74

UniProt

P9WP43

Expression Region

33-217aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 33-217aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DPCSDIAVVFARGTHQASGLGDVGEAFVDSLTSQVGGRSIGVYAVNYPASDDYRASASNGSDDASAHIQRTVASCPNTRIVLGGYSQGATVIDLSTSAMPPAVADHVAAVALFGEPSSGFSSMLWGGGSLPTIGPLYSSKTINLCAPDDPICTGGGNIMAHVSYVQSGMTSQAATFAANRLDHAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propyl Gallate 98% Extrapure
02215 00500 500 g

Propyl Gallate 98% Extrapure

Sign In for Pricing
View Details
Anti-Hu CD69 APC
1A-552-T025 25 Tests

Anti-Hu CD69 APC

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Allantoinase (allB)
MBS1227140-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Allantoinase (allB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Allantoinase (allB)
MBS1227140-02 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 Allantoinase (allB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Allantoinase (allB)
MBS1227140-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O127:H6 Allantoinase (allB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 Allantoinase (allB)
MBS1227140-04 0.1 mg (Yeast)

Recombinant Escherichia coli O127:H6 Allantoinase (allB)

Sign In for Pricing
View Details