Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pax2 Rabbit Polyclonal Antibody (Biotin)

Pax2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Op, Pax, Opdc, Pax-2

UniProt

P32114

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig A Kinase Anchor Protein 1 (AKAP1) ELISA Kit
abx357497 96 Well

Guinea pig A Kinase Anchor Protein 1 (AKAP1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Helicobacter pylori ATP synthase subunit c (atpE)
orb2934336-01 20 µg

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori ATP synthase subunit c (atpE)
orb2934336-02 100 µg

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
CRISP3 Antibody
orb520575-01 50 μL

CRISP3 Antibody

Sign In for Pricing
View Details
CRISP3 Antibody
orb520575-02 100 µL

CRISP3 Antibody

Sign In for Pricing
View Details
Recombinant Human ULBP1 protein, C-His tag
IMP-1208 10 µg

Recombinant Human ULBP1 protein, C-His tag

Sign In for Pricing
View Details