Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

This Recombinant Helicobacter pylori ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1CS52

Expression Region

1-105

Origin

Helicobacter pylori (strain HPAG1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLALFFLALAGVAFAHDGGMGGMDMIKSYSILGAMIGLGIAAFGGAIGMGNAAAATIT GTARNPGVGGKLLTTMFVAMAMIEAQVIYTLVFAIIAIYSNPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB (LN-3), CF647 conjugate, 0.1mg/mL
BNC470057-100 1x 100 µL

HLA-DRB (LN-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MCM7 Antibody
RC-4815-01 50 μL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
Recombinant MCM7 Antibody
RC-4815-02 100 µL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
Recombinant MCM7 Antibody
RC-4815-03 1 mL

Recombinant MCM7 Antibody

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), Biotin conjugate, 0.1mg/mL
BNCB0745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human gamma TubULin (TUBG2) activation kit by CRISPRa
GA109051 1 Kit

Human gamma TubULin (TUBG2) activation kit by CRISPRa

Sign In for Pricing
View Details