Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Myf5 Rabbit Polyclonal Antibody (FITC)

Myf5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D3ZVU3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Myf5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100253

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS15 ORF Vector (Human) (pORF)
ORF006677 1.0 µg DNA

MRPS15 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FCER1A (High Affinity Immunoglobulin epsilon Receptor Subunit alpha, Fc-epsilon RI-alpha, FcERI, IgE Fc Receptor Subunit alpha, FCE1A) (FITC)
126719-FITC 100 µL

FCER1A (High Affinity Immunoglobulin epsilon Receptor Subunit alpha, Fc-epsilon RI-alpha, FcERI, IgE Fc Receptor Subunit alpha, FCE1A) (FITC)

Sign In for Pricing
View Details
Recombinant human Fatty acid-binding protein, heart
MBS717077-01 0.05 mg

Recombinant human Fatty acid-binding protein, heart

Sign In for Pricing
View Details
Recombinant human Fatty acid-binding protein, heart
MBS717077-02 0.2 mg

Recombinant human Fatty acid-binding protein, heart

Sign In for Pricing
View Details
Recombinant human Fatty acid-binding protein, heart
MBS717077-03 0.5 mg

Recombinant human Fatty acid-binding protein, heart

Sign In for Pricing
View Details
Recombinant human Fatty acid-binding protein, heart
MBS717077-04 1 mg

Recombinant human Fatty acid-binding protein, heart

Sign In for Pricing
View Details