Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4930567H17Rik Rabbit Polyclonal Antibody (Biotin)

4930567H17Rik Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q3V0K5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028979

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS504129 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human PARVB activation kit by CRISPRa
GA109267 1 Kit

Human PARVB activation kit by CRISPRa

Sign In for Pricing
View Details
CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate
LY419672 100 µg

CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate

Sign In for Pricing
View Details
CK 1827452
TRC-C544000-5MG 5 mg

CK 1827452

Sign In for Pricing
View Details
Uncoated Human CCL15/MIP-5 (C-C motif chemokine 15/Macrophage inflammatory protein 5) ELISA Kit
E-UNEL-H0397-01 5x 96 Tests

Uncoated Human CCL15/MIP-5 (C-C motif chemokine 15/Macrophage inflammatory protein 5) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CCL15/MIP-5 (C-C motif chemokine 15/Macrophage inflammatory protein 5) ELISA Kit
E-UNEL-H0397-02 15x 96 Tests

Uncoated Human CCL15/MIP-5 (C-C motif chemokine 15/Macrophage inflammatory protein 5) ELISA Kit

Sign In for Pricing
View Details