Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP90 Rabbit Polyclonal Antibody (HRP)

ZFP90 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FIK, NK10, ZNF756, zfp-90

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFP90

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEECGGAQSLGNCDQVLRGYQVSKPEVIFKLEQGEEPWISEGEIQRPFYP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_085375

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR20A (NM_198441) Human Over-expression Lysate
E45H16222-2 20 µg

PRR20A (NM_198441) Human Over-expression Lysate

Sign In for Pricing
View Details
Heat Shock Protein 70, Universal (HSP70)
MBS602471-01 0.25 mL

Heat Shock Protein 70, Universal (HSP70)

Sign In for Pricing
View Details
Heat Shock Protein 70, Universal (HSP70)
MBS602471-02 5x 0.25 mL

Heat Shock Protein 70, Universal (HSP70)

Sign In for Pricing
View Details
Chicken A Disintegrin And Metalloprotease 10 ELISA kit
GTR10456984 96 Well

Chicken A Disintegrin And Metalloprotease 10 ELISA kit

Sign In for Pricing
View Details
Human Tumor type M2 Pyruvate Kinase ELISA kit
GTR10432967 96 Well

Human Tumor type M2 Pyruvate Kinase ELISA kit

Sign In for Pricing
View Details
UKHC antibody
orb74151 100 µL

UKHC antibody

Sign In for Pricing
View Details