Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP95 Rabbit Polyclonal Antibody (Biotin)

ZFP95 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP95, ZFP-95, ZNF914, ZSCAN37

UniProt

Q9Y2L8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_055384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GC Column, H1-17MS, 20m*0.18mm*0.18μm, 1pc/pk
14011211 1 PC

GC Column, H1-17MS, 20m*0.18mm*0.18μm, 1pc/pk

Sign In for Pricing
View Details
KIT Antibody (Ascites)
MBS9200409-01 0.1 mL

KIT Antibody (Ascites)

Sign In for Pricing
View Details
KIT Antibody (Ascites)
MBS9200409-02 5x 0.1 mL

KIT Antibody (Ascites)

Sign In for Pricing
View Details
RCN2 Peptide - middle region
orb2001163 100 µg

RCN2 Peptide - middle region

Sign In for Pricing
View Details
Rabbit Polyclonal RUSC2 Antibody [mFluor Violet 610 SE]
NBP2-81786MFV610 0.1 mL

Rabbit Polyclonal RUSC2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lentiviral mouse Cd300ld3 shRNA (UAS) - Lentiviral mouse Cd300ld3 shRNA (UAS, iRFP) (25)
GTR15149282 1 Vial

Lentiviral mouse Cd300ld3 shRNA (UAS) - Lentiviral mouse Cd300ld3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details