RCN2 Peptide - middle region
RCN2 Peptide - middle region
Product Specifications
Product Name Alternative
E6BP, ERC55, ERC-55, TCBP49
UniProt
Q14257
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RCN2 Rabbit Polyclonal Antibody (orb589060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001258766.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6155347-01 0.1 mL
TBX5 (T-box Transcription Factor TBX5, T-box Protein 5) (HRP)
Sign In for Pricing
View Details