Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP7 Rabbit Polyclonal Antibody (Biotin)

BMP7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OP-1

UniProt

P18075

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Antibody
orb334954 100 µg

CD19 Antibody

Sign In for Pricing
View Details
Lys01 trihydrochloride
B2117-5 5 mg

Lys01 trihydrochloride

Sign In for Pricing
View Details
SMC2, CT (SMC Protein 2, Structural Maintenance Of Chromosomes Protein 2, Chromosome-associated Protein E, hCAP-E, XCAP-E Homolog, SMC-2, CAPE, SMC2L1, PRO0324) (MaxLight 550)
MBS6501406-01 0.1 mL

SMC2, CT (SMC Protein 2, Structural Maintenance Of Chromosomes Protein 2, Chromosome-associated Protein E, hCAP-E, XCAP-E Homolog, SMC-2, CAPE, SMC2L1, PRO0324) (MaxLight 550)

Sign In for Pricing
View Details
SMC2, CT (SMC Protein 2, Structural Maintenance Of Chromosomes Protein 2, Chromosome-associated Protein E, hCAP-E, XCAP-E Homolog, SMC-2, CAPE, SMC2L1, PRO0324) (MaxLight 550)
MBS6501406-02 5x 0.1 mL

SMC2, CT (SMC Protein 2, Structural Maintenance Of Chromosomes Protein 2, Chromosome-associated Protein E, hCAP-E, XCAP-E Homolog, SMC-2, CAPE, SMC2L1, PRO0324) (MaxLight 550)

Sign In for Pricing
View Details
Anti-TIGD1 Antibody Picoband®, Dylight550 Conjugate
A17411-1-Dylight550 100 µg

Anti-TIGD1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Guinea pig Oncoprotein Induced Transcript 3 ELISA Kit
MBS725567-01 48 Well

Guinea pig Oncoprotein Induced Transcript 3 ELISA Kit

Sign In for Pricing
View Details