Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19 Antibody

Goat polyclonal antibody to CD19. CD19 is a type I transmembrane glycoprotein with 2 C-type Ig domains and multiple phosphorylation sites on long cytoplasmic domain. It is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. It is a major B lineage marker.

Product Specifications

Product Name Alternative

B4, Bgp95, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, differentiation antigen CD19, T-cell surface antigen Leu-12 antibody.

Reactivity

Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

Immunogen

Antigen: Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. Antigen Sequence: YAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR

Target

CD19 molecule

Clonality

Polyclonal

Conjugation

Unconjugated

Field of Research

Immunology & Inflammation

Purification

Epitope affinity purified

Concentration

Please inquire

Dilution

WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000

Form

​Polyclonal antibody supplied as a 200 μl (3 mg/ml) aliquot in PBS. This Ab does not contain preservatives. Glycerol and azide FREE. This antibody is epitope-affinity purified from goat antiserum.

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Applications Notes

The antibody solution should be gently mixed before use.

Tested Applications

IHC-Fr, IHC-P, WB

Host or Source

Goat

Isotype

IgG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (HRP)
MBS6180996-01 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (HRP)

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (HRP)
MBS6180996-02 5x 0.1 mL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (HRP)

Sign In for Pricing
View Details
LOC100503915 3'UTR Luciferase Stable Cell Line
TU111918 1.0 mL

LOC100503915 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KChIP1, CT (Kv Channel-interacting Protein 1, KChIP1, A-type Potassium Channel Modulatory Protein 1, Potassium Channel-interacting Protein 1, Vesicle APC-binding Protein, KCNIP1, VABP) (AP) discontinued
K0136-01A-AP 200 µL

KChIP1, CT (Kv Channel-interacting Protein 1, KChIP1, A-type Potassium Channel Modulatory Protein 1, Potassium Channel-interacting Protein 1, Vesicle APC-binding Protein, KCNIP1, VABP) (AP) discontinued

Sign In for Pricing
View Details
(3S,4R,17R,20S) -17-Hydroxy-3-O-β-D-xylopyranose (1-2) -β-D-glucopyranosyl-26-O-β-D-glucopyranosyl-28-O-β-D-glucopyranosyl-21,24-epoxybaccharane
M38430-01 100 mg

(3S,4R,17R,20S) -17-Hydroxy-3-O-β-D-xylopyranose (1-2) -β-D-glucopyranosyl-26-O-β-D-glucopyranosyl-28-O-β-D-glucopyranosyl-21,24-epoxybaccharane

Sign In for Pricing
View Details
(3S,4R,17R,20S) -17-Hydroxy-3-O-β-D-xylopyranose (1-2) -β-D-glucopyranosyl-26-O-β-D-glucopyranosyl-28-O-β-D-glucopyranosyl-21,24-epoxybaccharane
M38430-02 25 mg

(3S,4R,17R,20S) -17-Hydroxy-3-O-β-D-xylopyranose (1-2) -β-D-glucopyranosyl-26-O-β-D-glucopyranosyl-28-O-β-D-glucopyranosyl-21,24-epoxybaccharane

Sign In for Pricing
View Details