Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alx3 Rabbit Polyclonal Antibody (Biotin)

Alx3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6RW14

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Alx3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FPACGPLEPYLPEPAKPPAKYLQDLGPGPVLNGGHFYEGSSEAEEKASKA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSL6 (Long-chain-fatty-acid--CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, ACSL6, ACS2, FACL6, KIAA0837, LACS5)
406076-01 50 µL

ACSL6 (Long-chain-fatty-acid--CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, ACSL6, ACS2, FACL6, KIAA0837, LACS5)

Sign In for Pricing
View Details
ACSL6 (Long-chain-fatty-acid--CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, ACSL6, ACS2, FACL6, KIAA0837, LACS5)
406076-02 100 µL

ACSL6 (Long-chain-fatty-acid--CoA Ligase 6, Long-chain Acyl-CoA Synthetase 6, LACS 6, ACSL6, ACS2, FACL6, KIAA0837, LACS5)

Sign In for Pricing
View Details
Sf3a1 3'UTR GFP Stable Cell Line
TU168677 1.0 mL

Sf3a1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD)
orb2920551-01 20 µg

Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD)

Sign In for Pricing
View Details
Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD)
orb2920551-02 100 µg

Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD)

Sign In for Pricing
View Details
ERAS (A28) Antibody Blocking peptide
orb1455727 500 µg

ERAS (A28) Antibody Blocking peptide

Sign In for Pricing
View Details