Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Welwitschia mirabilis Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
B2Y1Z0
Expression Region
1-160
Origin
Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVTKKPDLKDPVLRARLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS IIGEPANPFATPLEILPEWYFFPVFQILRTVPNKFFGVLLMTSVPFGLLTVPFLENVNQF QNPFRRPVATSVFLIGTVISLWLGFGAVLPIEESLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880373-500 1x 500 µL
Human IgM Immunoglobulin (IM373), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040563-500 1x 500 µL
Cytokeratin 18 (DE-K18), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941864-500 1x 500 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details