Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR4A1 Rabbit Polyclonal Antibody (HRP)

NR4A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HMR, N10, TR3, NP10, GFRP1, NAK-1, NGFIB, NUR77

UniProt

P22736

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NR4A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIT1 Human Gene Knockout Kit (CRISPR)
KN420552 1 Kit

RIT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MyoD1 (5.8A + MYD712), CF594 conjugate, 0.1mg/mL
BNC940713-100 1x 100 µL

MyoD1 (5.8A + MYD712), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NEUROD4 activation kit by CRISPRa
GA111755 1 Kit

Human NEUROD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Evx2 (C-term) Rabbit Polyclonal Antibody
AP11393PU-N 400 µL

Evx2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BHMT2 Polyclonal Antibody
E-AB-52473-01 20 µL

BHMT2 Polyclonal Antibody

Sign In for Pricing
View Details
BHMT2 Polyclonal Antibody
E-AB-52473-02 60 µL

BHMT2 Polyclonal Antibody

Sign In for Pricing
View Details