Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP8 Rabbit Polyclonal Antibody (HRP)

AKAP8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKAP-8, AKAP95, AKAP 95, AKAP-95

UniProt

O43823

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiQuik™ L-Glutamate Quick Test Strips
QQGLUT10 10 Tests

QuantiQuik™ L-Glutamate Quick Test Strips

Sign In for Pricing
View Details
Recombinant Human ITIH3 Protein (His Tag)
PKSH032658-01 10 µg

Recombinant Human ITIH3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ITIH3 Protein (His Tag)
PKSH032658-02 50 µg

Recombinant Human ITIH3 Protein (His Tag)

Sign In for Pricing
View Details
RbAp46 (RBBP7) Human Gene Knockout Kit (CRISPR)
KN417969 1 Kit

RbAp46 (RBBP7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human BHLHA15 activation kit by CRISPRa
GA116177 1 Kit

Human BHLHA15 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS506198 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details