Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl2 Rabbit Polyclonal Antibody (Biotin)

Arntl2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MO, BMA, CLIF, MOP9, BMAL2, bHLHe, bHLHe6, 4632430A05Rik

UniProt

Q2VPD4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_758513

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MYPOP Protein
E30P09181A 50 µg

Recombinant Human MYPOP Protein

Sign In for Pricing
View Details
Mouse Hey2 qPCR Primer Pair
QM14642S 200 Tests

Mouse Hey2 qPCR Primer Pair

Sign In for Pricing
View Details
C6orf32 (Family with Sequence Similarity 65, Member B, C6orf32, DIFF40, DIFF48, KIAA0386, PL48) (MaxLight 405)
MBS6194739-01 0.1 mL

C6orf32 (Family with Sequence Similarity 65, Member B, C6orf32, DIFF40, DIFF48, KIAA0386, PL48) (MaxLight 405)

Sign In for Pricing
View Details
C6orf32 (Family with Sequence Similarity 65, Member B, C6orf32, DIFF40, DIFF48, KIAA0386, PL48) (MaxLight 405)
MBS6194739-02 5x 0.1 mL

C6orf32 (Family with Sequence Similarity 65, Member B, C6orf32, DIFF40, DIFF48, KIAA0386, PL48) (MaxLight 405)

Sign In for Pricing
View Details
AREG (Amphiregulin, AR, CRDGF, MGC13647, SDGF) (MaxLight 550)
MBS6407044-01 0.1 mL

AREG (Amphiregulin, AR, CRDGF, MGC13647, SDGF) (MaxLight 550)

Sign In for Pricing
View Details
AREG (Amphiregulin, AR, CRDGF, MGC13647, SDGF) (MaxLight 550)
MBS6407044-02 5x 0.1 mL

AREG (Amphiregulin, AR, CRDGF, MGC13647, SDGF) (MaxLight 550)

Sign In for Pricing
View Details