Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRND, Human (HEK293, His)

PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities.Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRND Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prnd-protein-human-hek-293-his.html

Smiles

RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG

Molecular Formula

23627 (Gene_ID) Q9UKY0 (R27-G152) (Accession)

Molecular Weight

Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sqstm1 Mouse shRNA Lentiviral Particle (Locus ID 18412)
TL515047V 500 µL Each

Sqstm1 Mouse shRNA Lentiviral Particle (Locus ID 18412)

Ask
View Details
HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2057793-01 0.1 mL

HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Ask
View Details
HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2057793-02 0.2 mL

HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Ask
View Details
HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2057793-03 0.5 mL

HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Ask
View Details
HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2057793-04 1 mL

HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Ask
View Details
HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2057793-05 5 mL

HRP-Linked Polyclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Ask
View Details