Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC38A2 Rabbit Polyclonal Antibody (HRP)

SLC38A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATA2, SAT2, SNAT2, PRO1068

UniProt

Q96QD8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061849

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SAA4 Protein (GST Tag)
PKSH031155 100 µg

Recombinant Human SAA4 Protein (GST Tag)

Sign In for Pricing
View Details
Zfp352 Mouse Gene Knockout Kit (CRISPR)
KN519797 1 Kit

Zfp352 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse FCRL1 Protein (aa 1-204, His Tag)
PKSM040425 100 µg

Recombinant Mouse FCRL1 Protein (aa 1-204, His Tag)

Sign In for Pricing
View Details
Perfluorononanoic Acid
TRC-P286490-25G 25 g

Perfluorononanoic Acid

Sign In for Pricing
View Details
Human BAX activation kit by CRISPRa
GA100400 1 Kit

Human BAX activation kit by CRISPRa

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
R1408-2 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details