Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF7 Rabbit Polyclonal Antibody (FITC)

ZNF7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX4, zf30, HF.16

UniProt

Q8N8Y4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_003407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), 0.2mg/mL
BNUB2760-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF594 conjugate, 0.1mg/mL
BNC942375-100 1x 100 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH033597-01 10 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH033597-02 50 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details
TentaGel® MB HMBA
MB300140.25G 25 g

TentaGel® MB HMBA

Sign In for Pricing
View Details
Recombinant Human TRAPPC8 protein (His tag)
PDEH100910-01 20 µg

Recombinant Human TRAPPC8 protein (His tag)

Sign In for Pricing
View Details