Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD12 Rabbit Polyclonal Antibody (FITC)

ANKRD12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ANCO1, GAC-1, ANCO-2, Nbla00144

UniProt

Q6UB98

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ANKRD12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVEKPYGRKSKDKIASYSKTPKIERSDVSKEMKEKSSMKRKLPFTISPSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001077094.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SLA2 Protein
E30P60255A 50 µg

Recombinant Human SLA2 Protein

Sign In for Pricing
View Details
Sheep Myosin Heavy Chain 1 ELISA Kit
MBS7266303-01 48 Well

Sheep Myosin Heavy Chain 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Myosin Heavy Chain 1 ELISA Kit
MBS7266303-02 96 Well

Sheep Myosin Heavy Chain 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Myosin Heavy Chain 1 ELISA Kit
MBS7266303-03 5x 96 Well

Sheep Myosin Heavy Chain 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Myosin Heavy Chain 1 ELISA Kit
MBS7266303-04 10x 96 Well

Sheep Myosin Heavy Chain 1 ELISA Kit

Sign In for Pricing
View Details
GFRA2 antibody
FNab03439 100 µg

GFRA2 antibody

Sign In for Pricing
View Details