Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF212 Rabbit Polyclonal Antibody (Biotin)

ZNF212 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF182, ZNFC150, C2H2-150

UniProt

Q9UDV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF212

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-Methoxyphenyl) ethylamine Hydrochloride
159184 25 g

2- (4-Methoxyphenyl) ethylamine Hydrochloride

Sign In for Pricing
View Details
Recombinant Human SENP2
PEH1490-01 10 µg

Recombinant Human SENP2

Sign In for Pricing
View Details
Recombinant Human SENP2
PEH1490-02 50 µg

Recombinant Human SENP2

Sign In for Pricing
View Details
Recombinant Human SENP2
PEH1490-03 500 µg

Recombinant Human SENP2

Sign In for Pricing
View Details
CTDSP2, NT (Small CTD Phosphatase 2, Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 2, Small C-terminal Domain Phosphatase 2, SCP2, Nuclear LIM Interactor-interacting Factor 2, NLI-interacting Factor 2, Protein OS-4, NIF2, OS4,
MBS6470774-01 0.1 mL

CTDSP2, NT (Small CTD Phosphatase 2, Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 2, Small C-terminal Domain Phosphatase 2, SCP2, Nuclear LIM Interactor-interacting Factor 2, NLI-interacting Factor 2, Protein OS-4, NIF2, OS4,

Sign In for Pricing
View Details
CTDSP2, NT (Small CTD Phosphatase 2, Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 2, Small C-terminal Domain Phosphatase 2, SCP2, Nuclear LIM Interactor-interacting Factor 2, NLI-interacting Factor 2, Protein OS-4, NIF2, OS4,
MBS6470774-02 5x 0.1 mL

CTDSP2, NT (Small CTD Phosphatase 2, Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 2, Small C-terminal Domain Phosphatase 2, SCP2, Nuclear LIM Interactor-interacting Factor 2, NLI-interacting Factor 2, Protein OS-4, NIF2, OS4,

Sign In for Pricing
View Details