Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf14 Rabbit Polyclonal Antibody (HRP)

Rnf14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARA54

UniProt

Q3ZAU6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001030167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl22 Peptide - middle region
orb2005584 100 µg

Mrpl22 Peptide - middle region

Sign In for Pricing
View Details
CLUH Polyclonal Conjugated Antibody
orb1628889 100 µL

CLUH Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
APG7 (Autophagy protein 7-like, APG7-like, Ubiquitin activating enzyme E1-like protein, hAGP7, APG7L, ATG7) (MaxLight 405) discontinued
030780-ML405 100 µL

APG7 (Autophagy protein 7-like, APG7-like, Ubiquitin activating enzyme E1-like protein, hAGP7, APG7L, ATG7) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Fibroblast Growth Factor 1 (FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (FITC)
MBS6417281-01 0.1 mL

Fibroblast Growth Factor 1 (FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (FITC)

Sign In for Pricing
View Details
Fibroblast Growth Factor 1 (FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (FITC)
MBS6417281-02 5x 0.1 mL

Fibroblast Growth Factor 1 (FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1) (FITC)

Sign In for Pricing
View Details
CD19 (FITC) discontinued
516259-01 50 Tests

CD19 (FITC) discontinued

Sign In for Pricing
View Details