Mrpl22 Peptide - middle region
Mrpl22 Peptide - middle region
Product Specifications
Product Name Alternative
E030011D16Rik, HSPC158, MRP-L25, Rpml25
UniProt
Q8BU88
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mrpl22 Rabbit Polyclonal Antibody (orb585449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_778166
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAEST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
214583-HRP 100 µL
CD152 (CTLA-4, Cytotoxic T-lymphocyte Protein 4) (HRP)
Sign In for Pricing
View Details 
orb3166287 100 µg
ATP synthase F (0) complex subunit 8 Antibody (Fluoro594)
Sign In for Pricing
View Details HV375147-02 100 Tests
Anti-Human CD272/BTLA Antibody (SAA0087), PerCP
Sign In for Pricing
View Details