Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP12 Rabbit Polyclonal Antibody (HRP)

PARP12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZC3H1, ARTD12, MST109, MSTP109, ZC3HDC1

UniProt

Q9H0J9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PARP12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_073587

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lambda Light Chain Antibody (SPM559) [DyLight 405]
NBP2-34424V 0.1 mL

Mouse Monoclonal Lambda Light Chain Antibody (SPM559) [DyLight 405]

Sign In for Pricing
View Details
Anti-CD49f/ITGA6 Polyclonal Antibody
PHD56001 100 μg

Anti-CD49f/ITGA6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH)
orb2936477-01 20 µg

Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH)

Sign In for Pricing
View Details
Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH)
orb2936477-02 100 µg

Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH)

Sign In for Pricing
View Details
Mouse PTGER3 (Prostaglandin E Receptor 3) ELISA Kit
EM2140 96 Tests

Mouse PTGER3 (Prostaglandin E Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Chitosan oligosaccharide
GU0761-1kg 1 Kg

Chitosan oligosaccharide

Sign In for Pricing
View Details