Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH)

This Recombinant Bovine respiratory syncytial virus Small hydrophobic protein (SH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Small hydrophobic protein, Small protein 1A

UniProt

P32554

Expression Region

1-81

Origin

Bovine respiratory syncytial virus (strain 391-2) (BRS)

Field of Research

Infectious Disease & Virology; Respiratory Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTSTIIEFTGEFWTYFTLVFMMLTIGFFFIVTSLVAAILNKLCDLNDHHTNSLDIRTK LRSDTQLITRAHEESINQSSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-100 1x 100 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CA72/733), CF740 conjugate, 0.1mg/mL
BNC740734-500 1x 500 µL

TAG-72 / CA72.4 (B72.3 + CA72/733), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF488A conjugate, 0.1mg/mL
BNC882598-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF568 conjugate, 0.1mg/mL
BNC681573-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details