Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc17a2 Rabbit Polyclonal Antibody (HRP)

Slc17a2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NP, NPT3, C730032N17Rik

UniProt

A6PW34

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFFSHFWLCTIIITYLPTYISTVLHVNIRDSGVLSSLPFIAASSCTILGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659085

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKLP1 Recombinant Rabbit mAb
orb2325088-01 25 µL

MKLP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
MKLP1 Recombinant Rabbit mAb
orb2325088-02 50 µL

MKLP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
MKLP1 Recombinant Rabbit mAb
orb2325088-03 100 µL

MKLP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
PBT 1033 (hydrochloride)
HY-105321A 1 Each

PBT 1033 (hydrochloride)

Sign In for Pricing
View Details
PPHLN1 Rabbit pAb Antibody
orb3016696 100 µL

PPHLN1 Rabbit pAb Antibody

Sign In for Pricing
View Details
Nerve Growth Factor Receptor, p75 (NGFR, Neurotrophin Receptor, NTR) (BSA & Azide Free) (MaxLight 490) discontinued
N2050-11X-ML490 100 µL

Nerve Growth Factor Receptor, p75 (NGFR, Neurotrophin Receptor, NTR) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details