Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody (Biotin)

KMT5B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CGI85, MRD51, CGI-85, SUV420H1

UniProt

Q4V775

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SUV420H1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH98121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Stk36 shRNA (UAS) - Lentiviral mouse Stk36 shRNA (UAS, iRFP) (25)
GTR15112730 1 Vial

Lentiviral mouse Stk36 shRNA (UAS) - Lentiviral mouse Stk36 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ANGPTL7 Peptide - middle region
orb1998767 100 µg

ANGPTL7 Peptide - middle region

Sign In for Pricing
View Details
SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI)
251999 100 µL

SP110 (SP110 Nuclear body Protein, FLJ22835, IFI41, IFI75, IPR1, VODI)

Sign In for Pricing
View Details
ASH2L (Absent, Small, or Homeotic-Like 2, Trithorax Protein)
475742 100 µL

ASH2L (Absent, Small, or Homeotic-Like 2, Trithorax Protein)

Sign In for Pricing
View Details
JWH 133
B7941-10 10 mg (Solution)

JWH 133

Sign In for Pricing
View Details
ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)
MBS6188728-01 0.1 mL

ACVR1B (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (MaxLight 405)

Sign In for Pricing
View Details