Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Peptide - middle region

ANGPTL7 Peptide - middle region

Product Specifications

Product Name Alternative

AngX, CDT6, dJ647M16.1

UniProt

O43827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066969.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Episterol
TRC-E588710-1MG 1 mg

Episterol

Sign In for Pricing
View Details
Gamma-Isodurylic Acid
TRC-I815120-10MG 10 mg

Gamma-Isodurylic Acid

Sign In for Pricing
View Details
Uncoated Human TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit
E-UNEL-H0369-01 5x 96 Tests

Uncoated Human TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit
E-UNEL-H0369-02 15x 96 Tests

Uncoated Human TNFRSF9 (Tumor Necrosis Factor Receptor Superfamily, Member 9) ELISA Kit

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL
BNC681530-100 1x 100 µL

Calpain 1 (CAPN1/1530), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein / NP (aa361-aa738) Protein (His Tag)
PKSV030167 100 µg

Recombinant EBOV (Sudan ebolavirus, strain Gulu) Nucleoprotein / NP (aa361-aa738) Protein (His Tag)

Sign In for Pricing
View Details