Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Rabbit Polyclonal Antibody (FITC)

Hpcal1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N, V, Nvp3, NVL-3, NVP-3, Vnsl3, Vsnl3, VILIP3

UniProt

P62748

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hpcal1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA 19-9 Mouse Monoclonal Antibody [Clone ID: 121SLE]
AM33126PU-T 20 µg

CA 19-9 Mouse Monoclonal Antibody [Clone ID: 121SLE]

Sign In for Pricing
View Details
5HT2C Receptor Recombinant Rabbit Monoclonal Antibody [JA31-31]
ET1704-87 100 µL

5HT2C Receptor Recombinant Rabbit Monoclonal Antibody [JA31-31]

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF568 conjugate, 0.1mg/mL
BNC683081-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF555 conjugate, 0.1mg/mL
BNC550922-500 1x 500 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS805101 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
16S V7-V9 Library Preparation Kit for Illumina
70900 24 Preparations

16S V7-V9 Library Preparation Kit for Illumina

Sign In for Pricing
View Details