Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM40 Rabbit Polyclonal Antibody (FITC)

TRIM40 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RNF35

UniProt

Q6P9F5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI40

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS16 (NM_139056) Human Over-expression Lysate
LH13931V 100 µg

ADAMTS16 (NM_139056) Human Over-expression Lysate

Sign In for Pricing
View Details
TBC1D25 Peptide - C-terminal region
orb2003957 100 µg

TBC1D25 Peptide - C-terminal region

Sign In for Pricing
View Details
Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit
abx360550-01 96 Tests

Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit

Sign In for Pricing
View Details
Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit
abx360550-02 5x 96 Tests

Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit

Sign In for Pricing
View Details
Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit
abx360550-03 10x 96 Tests

Pig Forkhead Box Protein O1 (FOXO1) ELISA Kit

Sign In for Pricing
View Details
Anti Human CD58 Flow Cytometry Monoclonal Clone TS291 PE/Cyanine5 Ready To Use 100 Tests
IMSAHUCD58TS291CPECY5100 100 Tests

Anti Human CD58 Flow Cytometry Monoclonal Clone TS291 PE/Cyanine5 Ready To Use 100 Tests

Sign In for Pricing
View Details