TBC1D25 Peptide - C-terminal region
TBC1D25 Peptide - C-terminal region
Product Specifications
Product Name Alternative
TBC1D25
UniProt
Q3MII6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D25 Rabbit Polyclonal Antibody (orb326096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002527
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STFEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1332218-01 0.02 mg (E-Coli)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details MBS1332218-02 0.1 mg (E-Coli)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details MBS1332218-03 0.02 mg (Yeast)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details MBS1332218-04 0.1 mg (Yeast)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details MBS1332218-05 0.02 mg (Baculovirus)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details MBS1332218-06 0.02 mg (Mammalian-Cell)
Recombinant Desulfovibrio desulfuricans Phosphoribosyl-AMP cyclohydrolase (hisI)
Sign In for Pricing
View Details