Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC1 Rabbit Polyclonal Antibody (HRP)

CLIC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G6, CL1C1, NCC27, CLCNL1

UniProt

Q502X1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAU / uPA Recombinant Protein
11-306 0.05 mg

PLAU / uPA Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal BACE-2 Antibody [Alexa Fluor 700]
NBP1-77309AF700 0.1 mL

Rabbit Polyclonal BACE-2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Human Pellino 1 (peli1) ELISA Kit
YP-W18711-01 48 Tests

Human Pellino 1 (peli1) ELISA Kit

Sign In for Pricing
View Details
Human Pellino 1 (peli1) ELISA Kit
YP-W18711-02 96 Tests

Human Pellino 1 (peli1) ELISA Kit

Sign In for Pricing
View Details
Transferrin Rabbit Polyclonal Antibody (HRP)
orb469545 100 µL

Transferrin Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CHST4 Antibody (C-term)
MBS9205717-01 0.08 mL

CHST4 Antibody (C-term)

Sign In for Pricing
View Details