Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Rabbit Polyclonal Antibody (HRP)

P2RX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P2X2, DFNA41

UniProt

Q9UBL9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_777362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken TIMP-2 (Tissue Inhibitors of Metalloproteinase 2) ELISA Kit
ECH0065 96 Tests

Chicken TIMP-2 (Tissue Inhibitors of Metalloproteinase 2) ELISA Kit

Sign In for Pricing
View Details
Tas2r108 (NM_020502) Mouse Tagged Lenti ORF Clone
MR220241L3 10 µg

Tas2r108 (NM_020502) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PBK  (5E1)
YF-MA11579 100 ug

Anti-PBK (5E1)

Sign In for Pricing
View Details
GPR22 Rabbit Polyclonal Antibody (Biotin)
orb2091031 100 µL

GPR22 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Hmgb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6462607 1.0 µg DNA

Hmgb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Olfr1308 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4133404 1.0 µg DNA

Olfr1308 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details