Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR22 Rabbit Polyclonal Antibody (Biotin)

GPR22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC129847

UniProt

Q99680

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YTKILQALNIRIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SA-HRP solution for YK070
YK070-SA Inquire

SA-HRP solution for YK070

Sign In for Pricing
View Details
IGF2BP2 (Insulin-like Growth Factor 2 mRNA-binding Protein 2, IGF2 mRNA-binding Protein 2, IMP-2, Hepatocellular Carcinoma Autoantigen p62, IGF-II mRNA-binding Protein 2, VICKZ Family Member 2, IMP2, VICKZ2) (APC)
128333-APC 100 µL

IGF2BP2 (Insulin-like Growth Factor 2 mRNA-binding Protein 2, IGF2 mRNA-binding Protein 2, IMP-2, Hepatocellular Carcinoma Autoantigen p62, IGF-II mRNA-binding Protein 2, VICKZ Family Member 2, IMP2, VICKZ2) (APC)

Sign In for Pricing
View Details
NUDT9 3'UTR Luciferase Stable Cell Line
TU016070 1.0 mL

NUDT9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Flamma® 675NA NHS ester
PNS1515_25 mg 25 mg

Flamma® 675NA NHS ester

Sign In for Pricing
View Details
TAF6 Rabbit Polyclonal Antibody
TA343551 100 µL

TAF6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MATK Knockout Cell Lysate
ABC-KC1125 100 µg

MATK Knockout Cell Lysate

Sign In for Pricing
View Details