Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF665 Rabbit Polyclonal Antibody (Biotin)

ZNF665 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZFP160L

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kif2a shRNA (UAS) - Lentiviral mouse Kif2a shRNA (UAS, iRFP) (25)
GTR15224366 1 Vial

Lentiviral mouse Kif2a shRNA (UAS) - Lentiviral mouse Kif2a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2230205 3x 1.0 µg

SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ERN1 siRNA (Human)
MBS8228765-01 15 nmol

ERN1 siRNA (Human)

Sign In for Pricing
View Details
ERN1 siRNA (Human)
MBS8228765-02 30 nmol

ERN1 siRNA (Human)

Sign In for Pricing
View Details
ERN1 siRNA (Human)
MBS8228765-03 5x 30 nmol

ERN1 siRNA (Human)

Sign In for Pricing
View Details
GRP94 Antibody / HSP90B1
V2908SAF-100UG 100 µg

GRP94 Antibody / HSP90B1

Sign In for Pricing
View Details