Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIH1 Rabbit Polyclonal Antibody (Biotin)

IFIH1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1

UniProt

Q9BYX4

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence GSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFL

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_071451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSM1 CRISPRa sgRNA lentivector (set of three targets)(Human)
22737121 3x 1.0µg DNA

GSM1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse PLEK siRNA
abx928941-01 15 nmol

Mouse PLEK siRNA

Sign In for Pricing
View Details
Mouse PLEK siRNA
abx928941-02 30 nmol

Mouse PLEK siRNA

Sign In for Pricing
View Details
PERK Polyclonal Antibody
UB-GEN-14665 100 µL

PERK Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant human NTAL protein
ATGP0561-250 250 µg

Recombinant human NTAL protein

Sign In for Pricing
View Details
RGD1562433 Rat shRNA Lentiviral Particle (Locus ID 499222)
TL703949V 500 µL Each

RGD1562433 Rat shRNA Lentiviral Particle (Locus ID 499222)

Sign In for Pricing
View Details