Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnmt1 Rabbit Polyclonal Antibody (HRP)

Dnmt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2

UniProt

P13864

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

183kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_034196

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Bcl-9 Antibody (1A2)
H00000607-M02 0.1 mg

Mouse Monoclonal Bcl-9 Antibody (1A2)

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin S Protein
NBP2-52349-0.05mg 0.05 mg

Recombinant Mouse Cathepsin S Protein

Sign In for Pricing
View Details
Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4)
orb2930048-01 20 µg

Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4)
orb2930048-02 100 µg

Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4)

Sign In for Pricing
View Details
APC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853E-01 25 µg

APC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
APC Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09853E-02 100 µg

APC Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details