Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4)
This Recombinant Cucumis sativus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
Photosystem I assembly protein Ycf4
UniProt
Q2QD78
Expression Region
1-184
Origin
Cucumis sativus (Cucumber)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNWRSERIWIEFLRGSRKISNFCWAFILFLGSLGFLLVGTSSYLGRDLISLFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEEIVSIFRWGFPGKNRRIFLRF LMKDIQSIRIEVKEGIYARRVLYMEIRGQGAIPLTRTDQNLTPREIEQKAAELAYFLRVP IEVF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740043-100 1x 100 µL
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details