Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKX2-2 Rabbit Polyclonal Antibody (HRP)

NKX2-2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ti, Nkx2., Nkx-2., Nkx2.2, tinman, Nkx-2.2

UniProt

P42586

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_035049

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNA2 Recombinant Rabbit Monoclonal Antibody [JM90-33]
ET1705-61 100 µL

KPNA2 Recombinant Rabbit Monoclonal Antibody [JM90-33]

Sign In for Pricing
View Details
OAS2 Human qPCR Primer Pair (NM_016817)
HP229366 200 Reactions

OAS2 Human qPCR Primer Pair (NM_016817)

Sign In for Pricing
View Details
RPAIN Mouse Monoclonal Antibody [Clone ID: OTI4A9]
CF810599 100 µg

RPAIN Mouse Monoclonal Antibody [Clone ID: OTI4A9]

Sign In for Pricing
View Details
ACADSB (NM_001609) Human Over-expression Lysate
LC419848 20 µg

ACADSB (NM_001609) Human Over-expression Lysate

Sign In for Pricing
View Details
SIRT3 Antibody
R31580 100 µg

SIRT3 Antibody

Sign In for Pricing
View Details
Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit
E-EL-H1598-01 24 Tests

Human TSLP (Thymic Stromal Lymphopoietin) ELISA Kit

Sign In for Pricing
View Details