Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb12 Rabbit Polyclonal Antibody (HRP)

Dnajb12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dj10, mDj10

UniProt

Q8K037

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Mouse

Tested Applications

WB

NCBI Accession Number

NP_064349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CCL17/TARC Protein (His Tag)
PKSH033735-01 10 µg

Recombinant Human CCL17/TARC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CCL17/TARC Protein (His Tag)
PKSH033735-02 50 µg

Recombinant Human CCL17/TARC Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), Biotin conjugate, 0.1mg/mL
BNCB0253-100 1x 100 µL

Cytokeratin, LMW (AE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SILAC - McCoy's 5A
0426 500 mL

SILAC - McCoy's 5A

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), Biotin conjugate, 0.1mg/mL
BNCB0949-100 1x 100 µL

Cytokeratin 7/17 (C-46), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ZIKV (strain Zika SPH2015) Envelope protein (Domain III, His Tag)
PKSV030270 100 µg

Recombinant ZIKV (strain Zika SPH2015) Envelope protein (Domain III, His Tag)

Sign In for Pricing
View Details