Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL2 Rabbit Polyclonal Antibody (Biotin)

ISL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Isle, 3110001N10Rik

UniProt

Q9CXV0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081673

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -Indoximod
T3S1967 500 mg

(S) -Indoximod

Sign In for Pricing
View Details
Genorise® Human IL-17 ELISA Test Service (up to 37 samples)
GR140010 37 Samples

Genorise® Human IL-17 ELISA Test Service (up to 37 samples)

Sign In for Pricing
View Details
PCP2 Rabbit Polyclonal Antibody (Fluoro550)
orb3094913 100 µg

PCP2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
PCMP-E89 Antibody
orb794244 2 mg

PCMP-E89 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Putative aminoacrylate hydrolase RutD (rutD)
MBS1258631-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O1:K1 / APEC Putative aminoacrylate hydrolase RutD (rutD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O1:K1 / APEC Putative aminoacrylate hydrolase RutD (rutD)
MBS1258631-02 0.02 mg (Yeast)

Recombinant Escherichia coli O1:K1 / APEC Putative aminoacrylate hydrolase RutD (rutD)

Sign In for Pricing
View Details